Allied Market Research
Loading...
0
New
New
2021
Styrenics Market

Styrenics Market by Polymer Type (Polystyrene, Styrene Butadiene Rubber, Acrylonitrile Butadiene Styrene, Unsaturated Polyester Resin and Other types) and Application (Automotive, Electrical and Electronics, Building and Construction, Packaging, Consumer Products and Others): Global Opportunity Analysis and Industry Forecast, 2021–2030

A12527
Pages: 350
Jul 2021 | 503 Views
   
Author(s) : Prakhar Jain , Eswara Prasad
Tables: 186
Charts: 7.
  • Formats*:

  • SIngle User License, Five User
    License & Enterprise User License

  • Data Pack Excel License

  • IComes with the additional cost
    of $2500.00 contact sales.

 

COVID-19

Pandemic disrupted the entire world and affected many industries.

Get detailed COVID-19 impact analysis on the Styrenics Market

Request Now !

Styrenics Market Statistics - 2030

The global styrenics market size was valued at $76.6 billion in 2020, and is projected to reach $134.9 billion by 2030, with global styrenics market forecast expected at a CAGR of 5.9% from 2021 to 2030.

Emergence of COVID-19 had negative impact in the growth of the global styrenics market, owing to the decline in demand from automotive, construction, and consumer industries.

Styrene is an organic compound that evaporates easily and has a sweet smell with a precursor of several copolymers such as polystyrene, unsaturated polyester and others. Polystyrene is a synthetic aromatic hydrocarbon which is made from a monomer known as styrene. It can be solid or foamed, it possesses a poor barrier to oxygen and water vapor and has low melting point. It is most widely used in plastics. The rapid increase in population and income led to increase in demand of various products in automotive, construction, and food processing. The increase in demand of these products have directly driven the demand for styrenics market. Additionally, increase in awareness among the people regarding the greenhouse gas effect on environment due to the presence of variety of building raw materials have increased the demand for the styrenics market. Governments across the globe are promoting sustainable ways such as wind energy, which can reduce greenhouse emissions that are primarily due to use of fossil fuels and industrialization. In the application of wind energy, the equipment used such as wind blades need to possess various properties such as light weight, and good strength. 17% of the raw material used for production of wind turbines is plastic or resin. The increase in demand for energy and various national plans toward green energy is expected to create abundant opportunities in the styrenics industry. The increase in population and presence of surplus funds in family led to increase in the purchasing power of the consumers in the automotive sector. The increase in demand for various vehicles, especially in personal vehicle and industrial trucks, forklifts and others, have driven the styrenics market growth. Styrene is used as a raw material in the manufacturing of wheels, wheel cover, in car interiors, and as a shock absorber. In addition, increase in strict rules of various national agencies toward personal safety in the transport vehicles is one of the major driving factors for the growth of the styrenics market size. The environmental awareness among people has increased the demand for eco-friendly products such as e-cars, creating ample opportunities for the growth of styrenics market during the forecast period. Demand for styrenics in Asia-Pacific is increasing at a rapid rate due to rapidly increasing urbanization in the region. In addition, countries such as India, Australia, Japan, Korea, and Indonesia, have highly invested in developing infrastructure sectors such as transport, smart cities, and food storage.  

Styrenics-Market-2021-2030

Get more information on this report : Request Sample Pages

In 2020, the American Conference of Governmental Industrial Hygienists announced a threshold limit values for styrene of 10 ppm TV-TWA and 20 ppm TLV-STEL. In addition to this, A3 carcinogen and ototoxicant notations were also adopted for styrene. In addition, several factors such as increasing environment and health concerns and limiting use of plastic material across the globe is expected to hamper the growth of the styrenics market throughout the forecast period. The pandemic also brought a negative impact on the automotive industry, construction, and consumer industry which led to decline in the demand for styrenics market growth for a short span of time.

The global styrenics market analysis is segmented on the basis of polymer type, application, and region. 

On the basis of polymer type, the global styrenics market is segmented into polystyrene, styrene butadiene rubber, acrylonitrile butadiene styrene, unsaturated polyester resin and other types. The applications covered in the study include automotive, electrical and electronics, building and construction, packaging, consumer products and others.

Styrenics Market
By Polymer Type

Your browser does not support the canvas element.

Polystyrene is projected to create abundant $ opportunity till 2030

Get more information on this report : Request Sample Pages

Region wise, the market is studied across North America, Europe, Asia-Pacific, and LAMEA. Presently, Asia-Pacific accounts for the largest share of the market, followed by North America and Europe. 
The major companies profiled in this report include BASF SE, Bayer Material Science, ENI S.P.A, Ineos Group AG, Royal DSM, Sabic, The Dow Chemical Company, Total SA, Repsol SA and Asahi Kasei Corporation. 

Styrenics Market
By Application

Your browser does not support the canvas element.

Industrial is projected as the most lucrative segment.

Get more information on this report : Request Sample Pages

As per styrenics market analysis, Asia-Pacific accounted for the largest share of the market in 2020, owing to increasing urbanization in the region.

In terms of polymer type, the polystyrene segment accounted for the largest market share in 2020, and is projected to grow at a CAGR of 6.5% from 2021 to 2030. 

By application, automotive segment generated the largest revenue in 2020, and is expected to grow at a CAGR of 4.9%.

Styrenics Market
By Region

2030
Asia Pacific 
North America
Europe
Lamea

Europe holds a dominant position in 2020

Get more information on this report : Request Sample Pages

Impact Of Covid-19 On The Global Styrenics Market

  • Emergence of COVID-19 had a negative impact on the growth of the global styrenics market share for a short period.
  • The shutdown of various industry production facilities led to decline in the demand for styrenics compounds in construction, household, and automotive sector.
  • The outbreak of pandemic resulted in increase in demand for styrenics compounds in medical sector for production of medical equipment.
  • Thus, the abovementioned factors are expected to limit the global styrenics market growth in current times.

Key Market Segments

By Polymer Type

  • Polystyrene
  • Styrene Butadiene Rubber
  • Acrylonitrile Butadiene Styrene
  • Unsaturated Polyester Resin
  • Other types

By Application

  • Automotive
  • Electrical and Electronics
  • Building and Construction
  • Packaging
  • Consumer products
  • Others

By Region

  • North America
    • U.S.
    • Canada
    • Mexico
  • Europe
    • Germany
    • France
    • Italy
    • Spain
    • UK
    • Rest of Europe
  • Asia-Pacific
    • China
    • Japan
    • India
    • South Korea
    • Rest of Asia Pacific
  • LAMEA
    • Brazil
    • Saudi Arabia
    • South Africa
    • Rest of LAMEA

Key players in the global styrenics market are:

  • BASF SE
  • Bayer Material Science
  • ENI S.P.A
  • Ineos Group AG
  • Royal DSM
  • Sabic
  • The Dow Chemical Company
  • Total SA
  • Repsol SA
  • Asahi Kasei Corporation
 

CHAPTER1:INTRODUCTION

1.1.Reportdescription
1.2.Keybenefitsforstakeholders
1.3.Keymarketsegments
1.4.Researchmethodology

1.4.1.Secondaryresearch
1.4.2.Primaryresearch

1.5.Analysttoolsandmodels

CHAPTER2:EXECUTIVESUMMARY

2.1.Keyfindingsofthestudy
2.2.CXOperspective

CHAPTER3:MARKETOVERVIEW

3.1.Marketdefinitionandscope
3.2.Keyfindings

3.2.1.Topinvestmentpockets

3.3.Porter’sfiveforcesanalysis
3.4.Marketdynamics

3.4.1.Drivers

3.4.1.1.Increasingdemandintheapplicationofthewindenergy
3.4.1.2.Increasingapplicationsinautomobileindustry
3.4.1.3.Increaseindemandforvariousplasticinconsumersector

3.4.2.Restraints

3.4.2.1.Increasingenvironmentandhealthconcerns

3.4.3.Opportunity

3.4.3.1.Rapiddevelopmentofinfrastructureindevelopingcountries

3.5.Pricinganalysis
3.6.Valuechainanalysis
3.7.Impactofkeyregulationsontheglobalstyrenicsmarket
3.8.ImpactofCOVID-19ontheglobalstyrenicsmarket

CHAPTER4:STYRENICSMARKET,BYPOLYMERTYPE

4.1.Overview

4.1.1.Marketsizeandforecast

4.2.Polystyrene

4.2.1.Keymarkettrends,growthfactors,andopportunities
4.2.2.Marketsizeandforecast,byregion
4.2.3.Comparativeshareanalysis,bycountry

4.3.StyreneButadieneRubber

4.3.1.Keymarkettrends,growthfactors,andopportunities
4.3.2.Marketsizeandforecast,byregion
4.3.3.Comparativeshareanalysis,bycountry

4.4.AcrylonitrileButadieneStyrene

4.4.1.Keymarkettrends,growthfactors,andopportunities
4.4.2.Marketsizeandforecast,byregion
4.4.3.Comparativeshareanalysis,bycountry

4.5.UnsaturatedPolyesterResin

4.5.1.Keymarkettrends,growthfactors,andopportunities
4.5.2.Marketsizeandforecast,byregion
4.5.3.Comparativeshareanalysis,bycountry

4.6.Othertypes

4.6.1.Keymarkettrends,growthfactors,andopportunities
4.6.2.Marketsizeandforecast,byregion
4.6.3.Comparativeshareanalysis,bycountry

CHAPTER5:STYRENICSMARKET,BYAPPLICATION

5.1.Overview

5.1.1.Marketsizeandforecast

5.2.Automotive

5.2.1.Keymarkettrends,growthfactors,andopportunities
5.2.2.Marketsizeandforecast,byregion
5.2.3.Comparativeshareanalysis,bycountry

5.3.Electricalsandelectronics

5.3.1.Keymarkettrends,growthfactors,andopportunities
5.3.2.Marketsizeandforecast,byregion
5.3.3.Comparativeshareanalysis,bycountry

5.4.BuildingandConstruction

5.4.1.Keymarkettrends,growthfactors,andopportunities
5.4.2.Marketsizeandforecast,byregion
5.4.3.Comparativeshareanalysis,bycountry

5.5.Packaging

5.5.1.Keymarkettrends,growthfactors,andopportunities
5.5.2.Marketsizeandforecast,byregion
5.5.3.Comparativeshareanalysis,bycountry

5.6.ConsumerProducts

5.6.1.Keymarkettrends,growthfactors,andopportunities
5.6.2.Marketsizeandforecast,byregion
5.6.3.Comparativeshareanalysis,bycountry

5.7.Others

5.7.1.Keymarkettrends,growthfactors,andopportunities
5.7.2.Marketsizeandforecast,byregion
5.7.3.Comparativeshareanalysis,bycountry

CHAPTER6:GLOBALSTYRENICSMARKET,BYREGION

6.1.Overview

6.1.1.Marketsizeandforecast,byregion

6.2.NorthAmerica

6.2.1.Keymarkettrends,growthfactors,andopportunities
6.2.2.Marketsizeandforecast,bypolymertype
6.2.3.Marketsizeandforecast,byapplication
6.2.4.Marketanalysis,bycountry
6.2.5.U.S.

6.2.5.1.Marketsizeandforecast,bypolymertype
6.2.5.2.Marketsizeandforecast,byapplication

6.2.6.Canada

6.2.6.1.Marketsizeandforecast,bypolymertype
6.2.6.2.Marketsizeandforecast,byapplication

6.2.7.Mexico

6.2.7.1.Marketsizeandforecast,bypolymertype
6.2.7.2.Marketsizeandforecast,byapplication

6.3.Europe

6.3.1.Keymarkettrends,growthfactors,andopportunities
6.3.2.Marketsizeandforecast,bypolymertype
6.3.3.Marketsizeandforecast,byapplication
6.3.4.Marketanalysis,bycountry

6.3.5.Germany

6.3.5.1.Marketsizeandforecast,bypolymertype
6.3.5.2.Marketsizeandforecast,byapplication

6.3.6.France

6.3.6.1.Marketsizeandforecast,bypolymertype
6.3.6.2.Marketsizeandforecast,byapplication

6.3.7.Italy

6.3.7.1.Marketsizeandforecast,bypolymertype
6.3.7.2.Marketsizeandforecast,byapplication

6.3.8.Spain

6.3.8.1.Marketsizeandforecast,bypolymertype
6.3.8.2.Marketsizeandforecast,byapplication

6.3.9.UK

6.3.9.1.Marketsizeandforecast,bypolymertype
6.3.9.2.Marketsizeandforecast,byapplication

6.3.10.RestofEurope

6.3.10.1.Marketsizeandforecast,bypolymertype
6.3.10.2.Marketsizeandforecast,byapplication

6.4.Asia-Pacific

6.4.1.Keymarkettrends,growthfactors,andopportunities
6.4.2.Marketsizeandforecast,bypolymertype
6.4.3.Marketsizeandforecast,byapplication
6.4.4.Marketanalysis,bycountry
6.4.5.China

6.4.5.1.Marketsizeandforecast,bypolymertype
6.4.5.2.Marketsizeandforecast,byapplication

6.4.6.Japan

6.4.6.1.Marketsizeandforecast,bypolymertype
6.4.6.2.Marketsizeandforecast,byapplication

6.4.7.India

6.4.7.1.Marketsizeandforecast,bypolymertype
6.4.7.2.Marketsizeandforecast,byapplication

6.4.8.SouthKorea

6.4.8.1.Marketsizeandforecast,bypolymertype
6.4.8.2.Marketsizeandforecast,byapplication

6.4.9.RestofAsia-Pacific

6.4.9.1.Marketsizeandforecast,bypolymertype
6.4.9.2.Marketsizeandforecast,byapplication

6.5.LAMEA

6.5.1.Keymarkettrends,growthfactors,andopportunities
6.5.2.Marketsizeandforecast,bypolymertype
6.5.3.Marketsizeandforecast,byapplication
6.5.4.Marketanalysis,bycountry
6.5.5.Brazil

6.5.5.1.Marketsizeandforecast,bypolymertype
6.5.5.2.Marketsizeandforecast,byapplication

6.5.6.SaudiArabia

6.5.6.1.Marketsizeandforecast,bypolymertype
6.5.6.2.Marketsizeandforecast,byapplication

6.5.7.SouthAfrica

6.5.7.1.Marketsizeandforecast,bypolymertype
6.5.7.2.Marketsizeandforecast,byapplication

6.5.8.RestofLAMEA

6.5.8.1.Marketsizeandforecast,bypolymertype
6.5.8.2.Marketsizeandforecast,byapplication

CHAPTER7:COMPETITIVELANDSCAPE

7.1.Introduction

7.1.1.Marketplayerpositioning,2020

7.2.Topwinningstrategies

7.2.1.Topwinningstrategies,byyear
7.2.2.Topwinningstrategies,bydevelopment
7.2.3.Topwinningstrategies,bycompany

7.3.Productmappingoftop10player
7.4.Competitivedashboard
7.5.Competitiveheatmap
7.6.Keydevelopments

7.6.1.Businessexpansions
7.6.2.Otherdevelopments

CHAPTER8:COMPANYPROFILES

8.1.BASFSE

8.1.1.Companyoverview
8.1.2.Keyexecutives
8.1.3.Companysnapshot
8.1.4.Operatingbusinesssegments
8.1.5.Productportfolio
8.1.6.R&Dexpenditure
8.1.7.Businessperformance
8.1.8.Keystrategicmovesanddevelopments

8.2.BayersAG

8.2.1.Companyoverview
8.2.2.Keyexecutives
8.2.3.Companysnapshot
8.2.4.Operatingbusinesssegments
8.2.5.Productportfolio
8.2.6.Businessperformance
8.2.7.Keystrategicmovesanddevelopments

8.3.EniS.P.A

8.3.1.Companyoverview
8.3.2.Keyexecutives
8.3.3.Companysnapshot
8.3.4.Operatingbusinesssegments
8.3.5.Productportfolio
8.3.6.R&Dexpenditure
8.3.7.Businessperformance
8.3.8.Keystrategicmovesanddevelopments

8.4.Ineosgroup

8.4.1.Companyoverview
8.4.2.Keyexecutives
8.4.3.Companysnapshot
8.4.4.Operatingbusinesssegments
8.4.5.Productportfolio
8.4.6.R&Dexpenditure
8.4.7.Businessperformance
8.4.8.Keystrategicmovesanddevelopments

8.5.DSM

8.5.1.Companyoverview
8.5.2.Keyexecutives
8.5.3.Companysnapshot
8.5.4.Operatingbusinesssegments
8.5.5.Productportfolio
8.5.6.R&Dexpenditure
8.5.7.Businessperformance
8.5.8.Keystrategicmovesanddevelopments

8.6.SABIC

8.6.1.Companyoverview
8.6.2.Keyexecutives
8.6.3.Companysnapshot
8.6.4.Operatingbusinesssegments
8.6.5.Productportfolio
8.6.6.Businessperformance

8.7.THEDOWCHEMICALCOMPANY

8.7.1.Companyoverview
8.7.2.Keyexecutives
8.7.3.Companysnapshot
8.7.4.Operatingbusinesssegments
8.7.5.Productportfolio
8.7.6.R&Dexpenditure
8.7.7.Businessperformance
8.7.8.Keystrategicmovesanddevelopments

8.8.TotalSA

8.8.1.Companyoverview
8.8.2.Keyexecutives
8.8.3.Companysnapshot
8.8.4.Operatingbusinesssegments
8.8.5.Productportfolio
8.8.6.R&Dexpenditure
8.8.7.Businessperformance

8.9.RepsolSA

8.9.1.Companyoverview
8.9.2.Keyexecutives
8.9.3.Companysnapshot
8.9.4.Operatingbusinesssegments
8.9.5.Productportfolio
8.9.6.R&Dexpenditure
8.9.7.Businessperformance
8.9.8.Keystrategicmovesanddevelopments

8.10.AsahiKaseiCorporation

8.10.1.Companyoverview
8.10.2.Keyexecutives
8.10.3.Companysnapshot
8.10.4.Operatingbusinesssegments
8.10.5.Productportfolio
8.10.6.R&Dexpenditure
8.10.7.Businessperformance 

LISTOFTABLES

TABLE01.PRICINGANALYSIS,BYTYPE,2020–2030($/UNIT)
TABLE02.PRICINGANALYSIS,BYREGION,2020–2030($/UNIT)
TABLE03.GLOBALSTYRENICSMARKET,BYPOLYMERTYPE,2020–2030(KILOTONS)
TABLE04.GLOBALSTYRENICSMARKET,BYPOLYMERTYPE,2020–2030($MILLION)
TABLE05.STYRENICSMARKETFORPOLYSTYRENE,BYREGION,2020–2030(KILOTONS)
TABLE06.STYRENICSMARKETFORPOLYSTYRENE,BYREGION,2020–2030($MILLION)
TABLE07.STYRENICSMARKETFORSTYRENEBUTADIENERUBBER,BYREGION,2020–2030(KILOTONS)
TABLE08.STYRENICSMARKETFORSTYRENEBUTADIENERUBBER,BYREGION,2020–2030($MILLION)
TABLE09.STYRENICSMARKETFORACRYLONITRILEBUTADIENESTYRENE,BYREGION,2020–2030(KILOTONS)
TABLE10.STYRENICSMARKETFORACRYLONITRILEBUTADIENESTYRENE,BYREGION,2020–2030($MILLION)
TABLE11.STYRENICSMARKETFORUNSATURATEDPOLYESTERRESIN,BYREGION,2020–2030(KILOTONS)
TABLE12.STYRENICSMARKETFORUNSATURATEDPOLYESTERRESIN,BYREGION,2020–2030($MILLION)
TABLE13.STYRENICSMARKETFOROTHERTYPES,BYREGION,2020–2030(KILOTONS)
TABLE14.STYRENICSMARKETFOROTHERTYPES,BYREGION,2020–2030($MILLION)
TABLE15.GLOBALSTYRENICSMARKET,BYAPPLICATION,2020–2030(KILOTONS)
TABLE16.GLOBALSTYRENICSMARKET,BYAPPLICATION,2020–2030($MILLION)
TABLE17.STYRENICSMARKETFORAUTOMOTIVE,BYREGION,2020–2030(KILOTONS)
TABLE18.STYRENICSMARKETFORAUTOMOTIVE,BYREGION,2020–2030($MILLION)
TABLE19.STYRENICSMARKETFORELECTRONICSANDELECTRICALS,BYREGION,2020–2030(KILOTONS)
TABLE20.STYRENICSMARKETFORELECTRONICSANDELECTRICALS,BYREGION,2020–2030($MILLION)
TABLE21.STYRENICSMARKETFORBUILDINGANDCONSTRUCTION,BYREGION,2020–2030(KILOTONS)
TABLE22.STYRENICSMARKETFORBUILDINGANDCONSTRUCTION,BYREGION,2020–2030($MILLION)
TABLE23.STYRENICSMARKETFORPACKAGING,BYREGION,2020–2030(KILOTONS)
TABLE24.STYRENICSMARKETFORPACKAGING,BYREGION,2020–2030($MILLION)
TABLE25.STYRENICSMARKETFORCONSUMERPRODUCTS,BYREGION,2020–2030(KILOTONS)
TABLE26.STYRENICSMARKETFORCONSUMERPRODUCTS,BYREGION,2020–2030($MILLION)
TABLE27.STYRENICSMARKETFOROTHERS,BYREGION,2020–2030(KILOTONS)
TABLE28.STYRENICSMARKETFOROTHERS,BYREGION,2020–2030($MILLION)
TABLE29.GLOBALSTYRENICSMARKET,BYREGION,2020-2030(KILOTONS)
TABLE30.GLOBALSTYRENICSMARKET,BYREGION,2020-2030($MILLION)
TABLE31.NORTHAMERICASTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE32.NORTHAMERICASTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE33.NORTHAMERICASTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE34.NORTHAMERICASTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE35.NORTHAMERICASTYRENICSMARKET,BYCOUNTRY,2020-2030(KILOTONS)
TABLE36.NORTHAMERICASTYRENICSMARKET,BYCOUNTRY,2020-2030($MILLION)
TABLE37.U.S.STYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE38.U.S.STYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE39.U.S.STYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE40.U.S.STYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE41.CANADASTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE42.CANADASTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE43.CANADASTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE44.CANADASTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE45.MEXICOSTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE46.MEXICOSTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE47.MEXICOSTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE48.MEXICOSTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE49.EUROPESTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE50.EUROPESTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE51.EUROPESTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE52.EUROPESTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE53.EUROPESTYRENICSMARKET,BYCOUNTRY,2020-2030(KILOTONS)
TABLE54.EUROPESTYRENICSMARKET,BYCOUNTRY,2020-2030($MILLION)
TABLE55.GERMANYSTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE56.GERMANYSTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE57.GERMANYSTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE58.GERMANYSTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE59.FRANCESTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE60.FRANCESTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE61.FRANCESTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE62.FRANCESTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE63.ITALYSTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE64.ITALYSTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE65.ITALYSTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE66.ITALYSTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE67.SPAINSTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE68.SPAINSTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE69.SPAINSTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE70.SPAINSTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE71.UKSTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE72.UKSTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE73.UKSTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE74.UKSTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE75.RESTOFEUROPESTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE76.RESTOFEUROPESTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE77.RESTOFEUROPESTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE78.RESTOFEUROPESTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE79.ASIAPACIFICSTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE80.ASIAPACIFICSTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE81.ASIAPACIFICSTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE82.ASIAPACIFICSTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE83.ASIA-PACIFICSTYRENICSMARKET,BYCOUNTRY,2020-2030(KILOTONS)
TABLE84.ASIA-PACIFICSTYRENICSMARKET,BYCOUNTRY,2020-2030($MILLION)
TABLE85.CHINASTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE86.CHINASTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE87.CHINASTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE88.CHINASTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE89.JAPANSTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE90.JAPANSTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE91.JAPANSTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE92.JAPANSTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE93.INDIASTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE94.INDIASTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE95.INDIASTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE96.INDIASTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE97.SOUTHKOREASTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE98.SOUTHKOREASTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE99.SOUTHKOREASTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE100.SOUTHKOREASTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE101.RESTOFASIAPACIFICSTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE102.RESTOFASIAPACIFICSTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE103.RESTOFASIAPACIFICSTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE104.RESTOFASIAPACIFICSTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE105.LAMEASTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE106.LAMEASTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE107.LAMEASTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE108.LAMEASTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE109.LAMEASTYRENICSMARKET,BYCOUNTRY,2020-2030(KILOTONS)
TABLE110.LAMEASTYRENICSMARKET,BYCOUNTRY,2020-2030($MILLION)
TABLE111.BRAZILSTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE112.BRAZILSTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE113.BRAZILSTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE114.BRAZILSTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE115.SAUDIARABIASTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE116.SAUDIARABIASTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE117.SAUDIARABIASTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE118.SAUDIARABIASTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE119.SOUTHAFRICASTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE120.SOUTHAFRICASTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE121.SOUTHAFRICASTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE122.SOUTHAFRICASTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE123.RESTOFLAMEASTYRENICSMARKET,BYPOLYMERTYPE,2020-2030(KILOTONS)
TABLE124.RESTOFLAMEASTYRENICSMARKET,BYPOLYMERTYPE,2020-2030($MILLION)
TABLE125.RESTOFLAMEASTYRENICSMARKET,BYAPPLICATION,2020-2030(KILOTONS)
TABLE126.RESTOFLAMEASTYRENICSMARKET,BYAPPLICATION,2020-2030($MILLION)
TABLE127.KEYNEWPRODUCTLAUNCHES(2021)
TABLE128.OTHERKEYDEVELOPMENTS(2017-2021)
TABLE129.BASFSE:KEYEXECUTIVES
TABLE130.BASFSE:COMPANYSNAPSHOT
TABLE131.BASFSE:OPERATINGSEGMENTS
TABLE132.BASFSE:PRODUCTPORTFOLIO
TABLE133.BASFSE:R&DEXPENDITURE,2018–2020($MILLION)
TABLE134.BASFSE:NETSALES,2018–2020($MILLION)
TABLE135.BAYERSAG:KEYEXECUTIVES
TABLE136.BAYERAG:COMPANYSNAPSHOT
TABLE137.BAYERAG:OPERATINGSEGMENTS
TABLE138.BAYERSAG:PRODUCTPORTFOLIO
TABLE139.BAYERAG:NETSALES,2018–2020($MILLION)
TABLE140.ENIS.P.A:KEYEXECUTIVES
TABLE141.ENIS.P.A:COMPANYSNAPSHOT
TABLE142.ENIS.P.A:OPERATINGSEGMENTS
TABLE143.ENIS.P.A:PRODUCTPORTFOLIO
TABLE144.ENIS.P.A:R&DEXPENDITURE,2018–2020($MILLION)
TABLE145.BASFSE:NETSALES,2018–2020($MILLION)
TABLE146.INEOSGROUP:KEYEXECUTIVES
TABLE147.INEOSGROUP:COMPANYSNAPSHOT
TABLE148.INEOSGROUP:OPERATINGSEGMENTS
TABLE149.ENIS.P.A:PRODUCTPORTFOLIO
TABLE150.INEOSGROUP:R&DEXPENDITURE,2018–2020($MILLION)
TABLE151.INEOSGROUP:NETSALES,2018–2020($MILLION)
TABLE152.DSM:KEYEXECUTIVES
TABLE153.DSM:COMPANYSNAPSHOT
TABLE154.DSM:OPERATINGSEGMENTS
TABLE155.DSM:PRODUCTPORTFOLIO
TABLE156.DSM:R&DEXPENDITURE,2018–2020($MILLION)
TABLE157.DSM:NETSALES,2018–2020($MILLION)
TABLE158.SABIC:KEYEXECUTIVES
TABLE159.SABIC:COMPANYSNAPSHOT
TABLE160.SABIC:OPERATINGSEGMENTS
TABLE161.SABIC:PRODUCTPORTFOLIO
TABLE162.SABIC:NETSALES,2018–2020($MILLION)
TABLE163.DOWCHEMICAL:KEYEXECUTIVES
TABLE164.DOWCHEMICAL:COMPANYSNAPSHOT
TABLE165.DOWCHEMICAL:OPERATINGSEGMENTS
TABLE166.DOWCHEMICAL:PRODUCTPORTFOLIO
TABLE167.DOWCHEMICAL:R&DEXPENDITURE,2018–2020($MILLION)
TABLE168.DOWCHEMICAL:NETSALES,2018–2020($MILLION)
TABLE169.TOTALSA:KEYEXECUTIVES
TABLE170.TOTALSA:COMPANYSNAPSHOT
TABLE171.TOTALSA:OPERATINGSEGMENTS
TABLE172.TOTALSA:PRODUCTPORTFOLIO
TABLE173.TOTALSA:R&DEXPENDITURE,2018–2020($MILLION)
TABLE174.TOTALSA:NETSALES,2018–2020($MILLION)
TABLE175.REPSOLSA:KEYEXECUTIVES
TABLE176.REPSOLSA:COMPANYSNAPSHOT
TABLE177.REPSOLSA:OPERATINGSEGMENTS
TABLE178.REPSOLSA:PRODUCTPORTFOLIO
TABLE179.REPSOLSA:R&DEXPENDITURE,2018–2020($MILLION)
TABLE180.REPSOLSA:NETSALES,2018–2020($MILLION)
TABLE181.ASAHIKASEICORPORATION:KEYEXECUTIVES
TABLE182.ASAHIKASEICORPORATION:COMPANYSNAPSHOT
TABLE183.ASAHIKASEICORPORATION:OPERATINGSEGMENTS
TABLE184.ASAHIKASEICORPORATION:PRODUCTPORTFOLIO
TABLE185.ASAHIKASEICORPORATION:R&DEXPENDITURE,2018–2020($MILLION)
TABLE186.ASAHIKASEICORPORATION:NETSALES,2018–2020($MILLION) 

LISTOFFIGURES

FIGURE01.GLOBALSTYRENICSMARKETSNAPSHOT
FIGURE02.GLOBALSTYRENICSMARKETSNAPSHOT
FIGURE03.GLOBALSTYRENICSMARKETSEGMENTATION
FIGURE04.TOPINVESTMENTPOCKETS
FIGURE05.BARGAININGPOWEROFSUPPLIERS
FIGURE06.BARGAININGPOWEROFBUYERS
FIGURE07.THREATOFNEWENTRANTS
FIGURE08.THREATOFSUBSTITUTES
FIGURE09.COMPETITIVERIVALRY
FIGURE10.GLOBALSTYRENICSMARKETDYNAMICS
FIGURE11.VALUECHAINANALYSIS
FIGURE12.GLOBALSTYRENICSMARKET,BYPOLYMERTYPE,2021–2030($MILILION)
FIGURE13.COMPARATIVEANALYSISOFSTYRENICSMARKETFORPOLYSTYRENE,BYCOUNTRY,2021&2030($MILLION)
FIGURE14.COMPARATIVEANALYSISOFSTYRENICSMARKETFORSTYRENEBUTADIENERUBBER,BYCOUNTRY,2021&2030($MILLION)
FIGURE15.COMPARATIVEANALYSISOFSTYRENICSMARKETFORACRYLONITRILEBUTADIENESTYRENE,BYCOUNTRY,2021&2030($MILLION)
FIGURE16.COMPARATIVEANALYSISOFSTYRENICSMARKETFOR250-500LTRS,BYCOUNTRY,2021&2030($MILLION)
FIGURE17.COMPARATIVEANALYSISOFSTYRENICSMARKETFOROTHERTYPES,BYCOUNTRY,2021&2030($MILLION)
FIGURE18.GLOBALSTYRENICSMARKET,BYAPPLICATION,2021–2030($MILILION)
FIGURE19.COMPARATIVEANALYSISOFSTYRENICSMARKETFORAUTOMOTIVE,BYCOUNTRY,2021&2030($MILLION)
FIGURE20.COMPARATIVEANALYSISOFSTYRENICSMARKETFORELECTRONICSANDELECTRICALS,BYCOUNTRY,2021&2030($MILLION)
FIGURE21.COMPARATIVEANALYSISOFSTYRENICSMARKETFORBUILDINGANDCONSTRUCTION,BYCOUNTRY,2021&2030($MILLION)
FIGURE22.COMPARATIVEANALYSISOFSTYRENICSMARKETFORPACKAGING,BYCOUNTRY,2021&2030($MILLION)
FIGURE23.COMPARATIVEANALYSISOFSTYRENICSMARKETFORCONSUMERPRODUCTS,BYCOUNTRY,2021&2030($MILLION)
FIGURE24.COMPARATIVEANALYSISOFSTYRENICSMARKETFOROTHERS,BYCOUNTRY,2021&2030($MILLION)
FIGURE25.U.S.STYRENICSMARKETREVENUE,2020–2030($MILLION)
FIGURE26.CANADASTYRENICSMARKETREVENUE,2020–2030($MILLION)
FIGURE27.MEXICOSTYRENICSMARKETREVENUE,2020–2030($MILLION)
FIGURE28.GERMANYSTYRENICSMARKETREVENUE,2020–2030($MILLION)
FIGURE29.FRANCESTYRENICSMARKETREVENUE,2020–2030($MILLION)
FIGURE30.ITALYSTYRENICSMARKETREVENUE,2020–2030($MILLION)
FIGURE31.SPAINSTYRENICSMARKETREVENUE,2020–2030($MILLION)
FIGURE32.UKSTYRENICSMARKETREVENUE,2020–2030($MILLION)
FIGURE33.RESTOFEUROPESTYRENICSMARKETREVENUE,2020–2030($MILLION)
FIGURE34.CHINASTYRENICSMARKETREVENUE,2020–2030($MILLION)
FIGURE35.JAPANSTYRENICSMARKETREVENUE,2020–2030($MILLION)
FIGURE36.INDIASTYRENICSMARKETREVENUE,2020–2030($MILLION)
FIGURE37.SOUTHKOREASTYRENICSMARKETREVENUE,2020–2030($MILLION)
FIGURE38.RESTOFASIA-PACIFICSTYRENICSMARKETREVENUE,2020–2030($MILLION)
FIGURE39.BRAZILSTYRENICSMARKETREVENUE,2020–2030($MILLION)
FIGURE40.SAUDIARABIASTYRENICSMARKETREVENUE,2020–2030($MILLION)
FIGURE41.SOUTHAFRICASTYRENICSMARKETREVENUE,2020–2030($MILLION)
FIGURE42.RESTOFLAMEASTYRENICSMARKETREVENUE,2020–2030($MILLION)
FIGURE43.MARKETPLAYERPOSITIONING,2020
FIGURE44.TOPWINNINGSTRATEGIES,BYYEAR,2019–2021
FIGURE45.TOPWINNINGSTRATEGIES,BYDEVELOPMENT,2019–2021(%)
FIGURE46.TOPWINNINGSTRATEGIES,BYCOMPANY,2017–2021
FIGURE47.PRODUCTMAPPINGOFTOP10PLAYERS
FIGURE48.COMPETITIVEDASHBOARD
FIGURE49.COMPETITIVEHEATMAPOFKEYPLAYERS
FIGURE50.BASFSE:R&DEXPENDITURE,2018–2020($MILLION)
FIGURE51.BASFSE:NETSALES,2018–2020($MILLION)
FIGURE52.BASFSE:REVENUESHAREBYSEGMENT,2020(%)
FIGURE53.BASFSE:REVENUESHAREBYREGION,2020(%)
FIGURE54.BAYERAG:NETSALES,2018–2020($MILLION)
FIGURE55.BAYERAG:REVENUESHAREBYSEGMENT,2020(%)
FIGURE56.BAYERAG:REVENUESHAREBYREGION,2020(%)
FIGURE57.ENIS.P.A:R&DEXPENDITURE,2018–2020($MILLION)
FIGURE58.ENIS.P.A:NETSALES,2018–2020($MILLION)
FIGURE59.ENIS.P.A:REVENUESHAREBYSEGMENT,2020(%)
FIGURE60.ENIS.P.A:REVENUESHAREBYREGION,2020(%)
FIGURE61.INEOSGROUP:R&DEXPENDITURE,2018–2020($MILLION)
FIGURE62.INEOSGROUP:NETSALES,2018–2020($MILLION)
FIGURE63.INEOSGROUP:REVENUESHAREBYSEGMENT,2020(%)
FIGURE64.INEOSGROUP:REVENUESHAREBYREGION,2020(%)
FIGURE65.DSM:R&DEXPENDITURE,2018–2020($MILLION)
FIGURE66.DSM:NETSALES,2018–2020($MILLION)
FIGURE67.DSM:REVENUESHAREBYSEGMENT,2020(%)
FIGURE68.DSM:REVENUESHAREBYREGION,2020(%)
FIGURE69.SABIC:NETSALES,2018–2020($MILLION)
FIGURE70.SABIC:REVENUESHAREBYSEGMENT,2020(%)
FIGURE71.SABIC:REVENUESHAREBYREGION,2020(%)
FIGURE72.DOWCHEMICAL:R&DEXPENDITURE,2018–2020($MILLION)
FIGURE73.DOWCHEMICAL:NETSALES,2018–2020($MILLION)
FIGURE74.DOWCHEMICAL:REVENUESHAREBYSEGMENT,2020(%)
FIGURE75.DOWCHEMICAL:REVENUESHAREBYREGION,2020(%)
FIGURE76.TOTALSA:R&DEXPENDITURE,2018–2020($MILLION)
FIGURE77.TOTALSA:NETSALES,2018–2020($MILLION)
FIGURE78.TOTALSA:REVENUESHAREBYSEGMENT,2020(%)
FIGURE79.TOTALSA:REVENUESHAREBYREGION,2020(%)
FIGURE80.REPSOLSA:R&DEXPENDITURE,2018–2020($MILLION)
FIGURE81.REPSOLSA:NETSALES,2018–2020($MILLION)
FIGURE82.REPSOLSA:REVENUESHAREBYSEGMENT,2020(%)
FIGURE83.REPSOLSA:REVENUESHAREBYREGION,2020(%)
FIGURE84.ASAHIKASEICORPORATION:R&DEXPENDITURE,2018–2020($MILLION)
FIGURE85.ASAHIKASEICORPORATION:NETSALES,2018–2020($MILLION)
FIGURE86.ASAHIKASEICORPORATION:REVENUESHAREBYSEGMENT,2020(%)
FIGURE87.ASAHIKASEICORPORATION:REVENUESHAREBYREGION,2020(%)

 
 

The global styrenics market is expected to witness increased demand during the forecast period due to rapidly growing automotive and packaging industry throughout the forecast period.

Several health and environmental concerns associated with styrenics based products are anticipated to hinder the growth of the styrenics market during the upcoming years. However, increasing demand for styrenics in the application of wind energy and increasing demand of styrenics in several end-use applications such as automotive parts and accessories, electrical and electronics, are some of the key factors expected to boost the demand for the styrenics market during the forecast period. In addition, rapidly increasing per capita income and high urbanization growth across the globe are expected to drive the global styrenics market demand during the forecast period.

The COVID-19 pandemic has negatively impacted the global styrenics market for a short span due to shutdown of various industry production facilities such as construction, household, and automotive sector leading to the decline in demand for styrenics compounds, thereby hampering the global styrenics market for a short span of time.

Moreover, companies are inheriting expansion strategies to boost the growth of the styrenics market throughout the forecast period.

PURCHASE OPTIONS

Start reading instantly ,This Report and over 13000+ thousand more Reports, Available with Avenue Library, T&C*

Call or Email us

U.S.-Canada
Toll-free :
+1-800-792-5285
Int'l : +1-503-894-6022
Europe : + 44-845-528-1300
Email : help@alliedmarketresearch.com
FREQUENTLY ASKED QUESTIONS?
Our Report Looks Like This
 

A. Increase in demand of styrenics for renewable and sustainable energy equipments, increasing application of styrenics in automotive industry are the key factors driving the growth of styrenicss market

A. Major applications of styrenics include automotive, electrical and electronics, building & construction, packaging and consumer goods.

A. Companies are inheriting partnership and acquisition strategies to support the growth of the styrenics market throughout the forecast period.

A. Asia Pacific significantly will provide more business opportunities for styrenics market in coming years

A. Polystyrene segment accounted for largest styrenics market share.

A. BASF SE, Bayer Material Science, ENI S.P.A, Ineos Group AG, Royal DSM, Sabic, The Dow Chemical Company, Total SA, Repsol SA and Asahi Kasei Corporation

A. Rapid development of infrastructure in developing as well as developed regions are the key trends expected to create increased growth opportunities throughout the forecast period.

A. The expected market value of styrenics by 2028 is US$ 120.5 billion

Allied Market Research Allied Market Research Allied Market Research
RELATED TAGS
 

HAVE QUESTIONS?
SPEAK WITH ANALYST

 

DID YOU MISS ANYTHING?
DO YOU HAVE SPECIFIC REQUIREMENTS?

 

Download Sample

OR

Purchase Full Report of
Styrenics Market

Start reading instantly.
This Report and over 13,000+ thousand more Reports, Available with Avenue Library. T&C*.

  • Online Only
  • $3,456
  • Online cloud access only
  • Restricted print, copy, paste & download
  • Read only
  •   Free quarterly industry update
  •   Free report update (Within 180 days)
  •   Subscription model sign in
  • Data Pack
  • $3,840
  • Restricted to one authorized user
  • One print only
  • Available in
    Excel
  •   Free quarterly industry update
  •   Free report update (Within 180 days)
  •   Subscription model sign in
  • Single User
  • $5,769
  • Restricted to one authorized user
  • One print only
  • Available in Excel & PDF
  •   Free quarterly industry update
  •   Free report update (Within 180 days)
  •   Subscription model sign in
  • Five Users
  • $6,450
  • Limited to five authorized users
  • Print upto five copies
  • Available in Excel & PDF
  •   Free quarterly industry update
  •   Free report update (Within 180 days)
  •   Subscription model sign in
  • Enterprise
    License/PDF

  • $9,995
  • Unlimited
    within
    company/enterprise
  • Available in Excel & PDF
  •   Free quarterly industry update
  •   Free report update (Within 180 days)
  •   Subscription model sign in
  • Library Membership
  • $ 699/mo
  • Published Content
    E-access
  • Company Profiles
    E-access
  • Newly Added Content Access
  • 10 PDF
    Downloads
  • 5 Excel Data
    Pack Downloads
  • 250 Company Profiles PDF Downloads
  • Buy Now

*Taxes/Fees, if applicable will be added during checkout. All prices in USD

 

Why Allied Market Research?

 

Infallible Methodology

To ensure high-level data integrity, accurate analysis, and impeccable forecasts

Analyst Support

For complete satisfaction

Customization

On-demand customization of scope of the report to exactly meet your needs

TARGETED MARKET VIEW

Targeted market view to provide pertinent information and save time of readers

 
 

Featured Reports

 

Erythropoietin Drugs Market

Global Opportunity Analysis and Industry Forecast, 2021–2028

Published in May 2021

Download Sample

Protein Therapeutics Market

Global Opportunity Analysis and Industry Forecast, 2017-2023

Published in Nov 2017

Download Sample

Surgical Equipment Market

Global Opportunity Analysis and Industry Forecast, 2020-2027

Published in Jan 2021

Download Sample

Medical Implant Market

Global Opportunity Analysis and Industry Forecast, 2020–2027

Published in Nov 2020

Download Sample

Featured Readings

 

Get fresh content delivered

Get insights on topics that are crucial for your business. Stay abreast of your interest areas.

 
Get Industry Data Alerts
 

Why Allied Market Research?

 

Infallible Methodology

To ensure high-level data integrity, accurate analysis, and impeccable forecasts

Analyst Support

For complete satisfaction

Customization

On-demand customization of scope of the report to exactly meet your needs

TARGETED MARKET VIEW

Targeted market view to provide pertinent information and save time of readers